PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07965A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 239aa    MW: 26937.8 Da    PI: 7.5042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07965AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-18449147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               rg W + Ede+l+++v ++G+++W++Ia++++ gR++k+c++rw++ 
  Oropetium_20150105_07965A  4 RGHWRPSEDEKLKELVSLYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                               899*****************************.***********996 PP

2Myb_DNA-binding52.51.1e-165699146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                               r ++++eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Oropetium_20150105_07965A 56 RSPFSEEEEELLLASHRVHGNR-WAVIARLFP-GRTDNAVKNHWHV 99
                               789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.795154IPR017930Myb domain
SMARTSM007172.4E-15352IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-29497IPR009057Homeodomain-like
PfamPF002491.5E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-26557IPR009057Homeodomain-like
CDDcd001677.10E-14748No hitNo description
SMARTSM007174.5E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129419.90255105IPR017930Myb domain
PfamPF002496.8E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2058104IPR009057Homeodomain-like
CDDcd001671.02E-57198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVS LYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFS  60
EEEEELLLAS HRVHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERTR MSNKCGGASA  120
TAAACSVEND NSRNAKKSRP EANSSSMLSS LLDKYRSELV AGPFAISHDN AEGCYRSTTN  180
EDAEKSVEFY DFLRVNASSS DTKCGSSIEE QDESRDDDQA EGQVQFIDFL KVGASHRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3421055108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794181e-130HF679418.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB12 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644562.11e-130PREDICTED: transcriptional activator Myb-like isoform X4
TrEMBLA0A060D7S31e-128A0A060D7S3_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G455869_P011e-128(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-72myb domain protein 52